PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G124300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 277aa    MW: 31666.1 Da    PI: 6.9823
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G124300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-20142202257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+++++ qle+Le++Fe+ n +p++++++e++ +l     ++e++V++WFqNrRa+ k+
  Manes.05G124300.1.p 142 RQRWAPKPAQLEILESMFEQsNTTPDRQRIREITIQLaehgPISETNVYNWFQNRRARSKR 202
                          89*****************99*******************99*****************97 PP

2Wus_type_Homeobox91.39.3e-30141204265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          +r+RW+P+p Q++iLe+++++   tP +++i++it +L+e+G i+++NV++WFQNr+aR+++kq
  Manes.05G124300.1.p 141 SRQRWAPKPAQLEILESMFEQSNTTPDRQRIREITIQLAEHGPISETNVYNWFQNRRARSKRKQ 204
                          689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.625138203IPR001356Homeobox domain
SuperFamilySSF466891.67E-17139206IPR009057Homeodomain-like
SMARTSM003899.2E-14140207IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-15141205IPR009057Homeodomain-like
CDDcd000865.82E-13142204No hitNo description
PfamPF000462.8E-18142202IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MYSVYCFFHC LFVCVASFLV LCVFKSQTQA CLVSVECPEI IVRQRGEKGR ENSRNPRKKK  60
VEMEEEEQYK NGVLGGGLGV KVMTDEQMEM LRKQISVYAT ICESLVQLHK TISAQQDFAG  120
MRSANLYSDP FLSYAFHKVP SRQRWAPKPA QLEILESMFE QSNTTPDRQR IREITIQLAE  180
HGPISETNVY NWFQNRRARS KRKQAALPPI PNHHDSAKDK ETKPDETQVD ENLAIMLNHM  240
YFQSPDIGGI DQLIGHTEYP LSYSSCLQVE QHDLSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510692.15e-95PREDICTED: WUSCHEL-related homeobox 8
TrEMBLB9R8P95e-95B9R8P9_RICCO; DNA binding protein, putative
STRINGPOPTR_0002s00980.13e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.13e-56WUSCHEL related homeobox 13